Recombinant Cow IL-17F protein (BSA and azide free) (ab177585)

Overview

Description

  • Nature
    Recombinant
  • Source
    Yeast
  • Amino Acid Sequence
    • Species
      Cow
    • Sequence
      QKPPRSGDSGLCPTLEDHIVRVDIRIRRRNQGVSFSRNLQNRSISPWDYN ITRDANRFPSEIAEAQCRHMGCINAEGQEDRTLNSVPIQQEFLVLRRKQN GCPGLFQLEKVLVTVGCTCVTPMVRHLHDPMADQVADQLS
    • Molecular weight
      19 kDa

Specifications

Our Abpromise guarantee covers the use of ab177585 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Purity
    >95% by SDS-PAGE .
    Purified by Ion-exchange chromatography
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C..

General Info

  • Alternative names
    • CANDF6
    • Cytokine ML 1
    • Cytokine ML-1
    • IL 17F
    • IL 24
    • IL-17F
    • Il17f
    • IL17F_HUMAN
    • Interleukin 17F
    • Interleukin 24
    • Interleukin-17F
    • ML 1
    • ML1
    • Mutant IL 17F
    • OTTHUMP00000016602
    see all
  • Function
    Ligand for IL17RA and IL17RC (PubMed:17911633). The heterodimer formed by IL17A and IL17F is a ligand for the heterodimeric complex formed by IL17RA and IL17RC (PubMed:18684971). Involved in stimulating the production of other cytokines such as IL6, IL8 and CSF2, and in regulation of cartilage matrix turnover (PubMed:11591732, PubMed:11591768, PubMed:11574464). Also involved in stimulating the proliferation of peripheral blood mononuclear cells and T-cells and in inhibition of angiogenesis (PubMed:11591732). Plays a role in the induction of neutrophilia in the lungs and in the exacerbation of antigen-induced pulmonary allergic inflammation.
  • Tissue specificity
    Expressed in activated, but not resting, CD4+ T-cells and activated monocytes.
  • Involvement in disease
    Candidiasis, familial, 6
  • Sequence similarities
    Belongs to the IL-17 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab177585 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177585.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up