Description

  • Product name

    Recombinant Cow IL-23 protein
    See all IL-23 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab209377 is purified by Ion Exchange Chromatography.
  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Cow
    • Sequence

      RAVSEDSSPAWTRGQQLSQQLCMLAWSAHLPMGHMDLPREEGGDKTTDDV PRIQCEDGCDPQGLRDNSQSCLQRIHRGLVFYEKLLGSDIFTGEPSLLPN GPVDQLHASILGLRELLQPKGHHWETEQTPSPIPSQPWQRLLLRLKILRS LQAFVAVAARVFAHGAATLSP
    • Predicted molecular weight

      19 kDa
    • Amino acids

      22 to 192
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab209377 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    ab209377 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

    .

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

    Constituents: 10% Trehalose, 90% PBS

  • Reconstitution
    Reconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein.

General Info

  • Alternative names

    • IL 23
    • IL 23 A
    • IL 23 subunit alpha
    • IL 23A
    • IL 23p19
    • IL-23 subunit alpha
    • IL-23-A
    • IL-23p19
    • IL12B
    • IL23
    • Il23a
    • IL23A_HUMAN
    • IL23P19
    • interleukin 12B
    • Interleukin 23 alpha subunit p19
    • Interleukin 23 p19 subunit
    • interleukin 23 subunit alpha
    • interleukin 23 subunit p19
    • interleukin six, G CSF related factor
    • Interleukin-23 subunit alpha
    • Interleukin-23 subunit p19
    • JKA3 induced upon T cell activation
    • MGC79388
    • P19
    • SGRF
    see all
  • Function

    Associates with IL12B to form the IL-23 interleukin, an heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to an heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
  • Tissue specificity

    Secreted by activated dendritic and phagocytic cells and keratinocytes. Also expressed by dermal Langerhans cells (at protein level).
  • Sequence similarities

    Belongs to the IL-6 superfamily.
  • Developmental stage

    Expressed by newborns dendritic cells.
  • Cellular localization

    Secreted. Secreted upon association with IL12B.
  • Information by UniProt

References

ab209377 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab209377.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up