Description

  • Product name

    Recombinant Cow MCP1 protein
    See all MCP1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purified by Ion-exchange chromatography
  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Cow
    • Sequence

      QPDAINSQVACCYTFNSKKISMQRLMNYRRVTSSKCPKEAVIFKTILGKE LCADPKQKWVQDSINYLNKKNQTPKP
    • Predicted molecular weight

      9 kDa
    • Amino acids

      24 to 99
    • Additional sequence information

      mature form.

Specifications

Our Abpromise guarantee covers the use of ab177583 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Form

    Lyophilised
  • Additional notes

    ab177583 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C..

    Information available upon request.

General Info

  • Alternative names

    • C-C motif chemokine 2
    • CCL2
    • CCL2_HUMAN
    • Chemokine (C C motif) ligand 2
    • GDCF 2
    • GDCF-2
    • GDCF2
    • HC11
    • HSMCR30
    • JE
    • MCAF
    • MCP 1
    • MCP-1
    • MCP1
    • MGC9434
    • Monocyte chemoattractant protein 1
    • Monocyte chemotactic and activating factor
    • Monocyte chemotactic protein 1
    • Monocyte secretory protein JE
    • SCYA2
    • Small inducible cytokine A2
    • Small inducible cytokine A2 (monocyte chemotactic protein 1, homologous to mouse Sig je)
    • Small inducible cytokine subfamily A (Cys Cys), member 2
    • Small-inducible cytokine A2
    • SMC CF
    • SMC-CF
    • SMCCF
    see all
  • Function

    Chemotactic factor that attracts monocytes and basophils but not neutrophils or eosinophils. Augments monocyte anti-tumor activity. Has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, like psoriasis, rheumatoid arthritis or atherosclerosis. May be involved in the recruitment of monocytes into the arterial wall during the disease process of atherosclerosis.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications

    Processing at the N-terminus can regulate receptor and target cell selectivity. Deletion of the N-terminal residue converts it from an activator of basophil to an eosinophil chemoattractant.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab177583 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177583.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up