Description

  • Product name

    Recombinant Cow Resistin protein (His tag)
    See all Resistin proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Cow
    • Sequence

      QSLCPIDKAISEKIQEVTTSLVPGAVRIIGLDCRSVTSRGSLVTCPSGFA VTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRLHIQ
    • Predicted molecular weight

      14 kDa including tags
    • Amino acids

      19 to 109
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 19 to 109. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab226437 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Adipose tissue specific secretory factor
    • Adipose tissue-specific secretory factor
    • ADSF
    • C/EBP epsilon regulated myeloid specific secreted cysteine rich protein
    • C/EBP epsilon regulated myeloid specific secreted cysteine rich protein precursor 1
    • C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein
    • CG5403
    • Cysteine rich secreted protein A12 alpha like 2
    • Cysteine rich secreted protein FIZZ3
    • Cysteine-rich secreted protein A12-alpha-like 2
    • Cysteine-rich secreted protein FIZZ3
    • dri
    • FIZZ 3
    • FIZZ3
    • Found in inflammatory zone 3
    • HXCP 1
    • HXCP1
    • MGC126603
    • MGC126609
    • PRO1199
    • Resistin
    • Resistin delta2
    • RETN
    • RETN 1
    • RETN_HUMAN
    • RETN1
    • RSTN
    • UNQ407
    • XCP 1
    • XCP1
    see all
  • Function

    Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes.
  • Tissue specificity

    Expressed only in fatty tissues.
  • Sequence similarities

    Belongs to the resistin/FIZZ family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226437 with 5% enrichment gel and 15% separation gel.

References

ab226437 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226437.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up