Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Cow
    • Sequence

      ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPY IWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQ LSNMIVRSCKCS
    • Molecular weight

      17 kDa including tags
    • Amino acids

      279 to 390
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 279 to 390. The signal peptide and Latency-associated peptide are not included.

Specifications

Our Abpromise guarantee covers the use of ab224869 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Cartilage-inducing factor
    • CED
    • Differentiation inhibiting factor
    • DPD1
    • LAP
    • Latency-associated peptide
    • Prepro transforming growth factor beta 1
    • TGF beta
    • TGF beta 1
    • TGF beta 1 protein
    • TGF-beta 1 protein
    • TGF-beta-1
    • TGF-beta-5
    • TGF-beta1
    • TGFB
    • Tgfb-1
    • tgfb1
    • TGFB1_HUMAN
    • TGFbeta
    • TGFbeta1
    • Transforming Growth Factor b1
    • Transforming Growth Factor beta 1
    • Transforming growth factor beta 1a
    • transforming growth factor beta-1
    • transforming growth factor, beta 1
    • Transforming Growth Factor-ß1
    see all
  • Function

    Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts.
  • Tissue specificity

    Highly expressed in bone. Abundantly expressed in articular cartilage and chondrocytes and is increased in osteoarthritis (OA). Co-localizes with ASPN in chondrocytes within OA lesions of articular cartilage.
  • Involvement in disease

    Defects in TGFB1 are the cause of Camurati-Engelmann disease (CE) [MIM:131300]; also known as progressive diaphyseal dysplasia 1 (DPD1). CE is an autosomal dominant disorder characterized by hyperostosis and sclerosis of the diaphyses of long bones. The disease typically presents in early childhood with pain, muscular weakness and waddling gait, and in some cases other features such as exophthalmos, facial paralysis, hearing difficulties and loss of vision.
  • Sequence similarities

    Belongs to the TGF-beta family.
  • Post-translational
    modifications

    Glycosylated.
    The precursor is cleaved into mature TGF-beta-1 and LAP, which remains non-covalently linked to mature TGF-beta-1 rendering it inactive.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

References

ab224869 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224869.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up