Recombinant Cynodon dactylon Major pollen allergen Cyn d 1 (CYND1) protein (Tagged) (ab225654)

Overview

  • Product name

    Recombinant Cynodon dactylon Major pollen allergen Cyn d 1 (CYND1) protein (Tagged)
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Cynodon dactylon (Bermuda grass)
    • Sequence

      AIGDKPGPNITATYGSKWLEARATFYGSNPRGAAPDDHGGACGYKDVDKP PFDGMTACGNEPIFKDGLGCRACYEIKCKEPVECSGEPVLVKITDKNYEH IAAYHFDLSGKAFGAMAKKGQEDKLRKAGELTLQFRRVKCKYPSGTKITF HIEKGSNDHYLALLVKYAAGDGNIVAVDIKPRDSDEFIPMKSSWGAIWRI DPKKPLKGPFSIRLTSEGGAHLVQDDVIPANWKPDTVYTSKLQFGA
    • Molecular weight

      32 kDa including tags
    • Amino acids

      1 to 246
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Cynodon dactylon (Bermuda grass) (Panicum dactylon) protein with 10xHis-SUMO tag at the N-terminus and Myc tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab225654 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab225654 with 5% enrichment gel and 15% separation gel.

References

ab225654 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225654.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up