Recombinant Cynomolgus monkey beta 2 Microglobulin + FCGRT heterodimer protein (Tagged) (Biotin) (ab246153)

Description

  • Product name

    Recombinant Cynomolgus monkey beta 2 Microglobulin + FCGRT heterodimer protein (Tagged) (Biotin)
  • Purity

    > 90 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Amino Acid Sequence 1

    • Species

      Cynomolgus monkey
    • Sequence

      AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYDSLRGQAEPCGA WVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELSP DNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANK ELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPGNPGFSVLTCSA FSFYPPELQLRFLRNGMAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHY CCIVQHAGLAQPLRVELETPAKSS
    • Predicted molecular weight

      34 kDa including tags
    • Amino acids

      24 to 297
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information

      Extracellular domain. Biotinylated using Avitag™ technology. Briefly, the single lysine residue in the Avitag™ is enzymatically labeled with biotin. Avitag™ sequence GLNDIFEAQKIEWHE.
    • Amino Acid Sequence 2

    • Species

      Cynomolgus monkey
    • Sequence

      IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVE HSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM
    • Predicted molecular weight

      13 kDa including tags
    • Amino acids

      21 to 119
    • Tags

      StrepII tag C-Terminus
    • Additional sequence information

      Full-length mature chain lacking the signal peptide.
  • Conjugation

    Biotin
  • Description

    Recombinant Cynomolgus monkey beta 2 Microglobulin + FCGRT/FCRN protein (Tagged) (Biotin)

Specifications

Our Abpromise guarantee covers the use of ab246153 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

    0.22 µm filtered

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long-term storage.

General Info

  • Cellular localization

    beta 2 Microglobulin: Secreted. Detected in serum and urine. FCGRT: Cell membrane.

Images

  • SDS-PAGE analysis of ab246153 under reducing conditions.

    The protein has a calculated MW of 34.1 kDa (FCGRT) and 13.0 kDa (beta 2 Microglobulin). The protein migrates as 40 kDa (FCGRT) and 14 kDa (beta 2 Microglobulin respectively on a SDS-PAGE gel under reducing conditions due to glycosylation.

     

References

ab246153 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246153.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up