Recombinant Cynomolgus monkey CD252 protein (His tag) (ab215620)

Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Species

      Cynomolgus monkey
    • Sequence

      HHHHHHHHQVSHQYPRIQSIKVQFTEYKKEEGFILTSQKEDEIMKVQNNS VIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVAS LTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
    • Molecular weight

      17 kDa including tags
    • Amino acids

      51 to 183
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab215620 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µm filtered solution.

  • Reconstitution
    Always centrifuge tubes before opening. Dissolve the lyophilized protein in ddH2O. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Do not mix by vortex or pipetting.

General Info

  • Alternative names

    • CD 134L
    • CD 252
    • CD134
    • CD134 ligand
    • CD134L
    • CD252
    • CD252 antigen
    • glycoprotein 34 kd
    • Glycoprotein Gp34
    • GP34
    • OX-40L
    • OX40 antigen ligand
    • OX40 ligand
    • OX40L
    • TAX transcriptionally-activated glycoprotein 1
    • TNFL4_HUMAN
    • Tnfsf4
    • Tumor necrosis factor (ligand) superfamily member 4
    • Tumor necrosis factor ligand superfamily member 4
    • TXGP1
    see all
  • Function

    Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
  • Involvement in disease

    Genetic variations in TNFSF4 influence susceptibility to systemic lupus erythematosus (SLE) [MIM:152700]. SLE is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. It is thought to represent a failure of the regulatory mechanisms of the autoimmune system. Note=The upstream region of TNFSF4 contains a single risk haplotype for SLE, which is correlated with increased expression of both cell-surface TNFSF4 and TNFSF4 transcripts. Increased levels of TNFSF4 are thought to augment T cell-APC interaction and the functional consequences of T cell activation, thereby destabilizing peripheral tolerance.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab215620.

    Lane 1: Non-reduced sample

    Lane 2: Reduced sample

References

ab215620 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215620.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up