Recombinant Cynomolgus Monkey CD3 delta + CD3 epsilon protein (ab200501)

Description

  • Product name

    Recombinant Cynomolgus Monkey CD3 delta + CD3 epsilon protein
    See all CD3 delta + CD3 epsilon proteins and peptides
  • Purity

    > 92 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Amino Acid Sequence 1

    • Species

      Cynomolgus monkey
    • Sequence

      QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGD RLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMD
    • Predicted molecular weight

      16 kDa including tags
    • Amino acids

      22 to 117
    • Tags

      His tag C-Terminus
    • Additional sequence information

      CD3 epsilon extracellular domain.
    • Amino Acid Sequence 2

    • Species

      Cynomolgus monkey
    • Sequence

      FKIPVEELEDRVFVKCNTSVTWVEGTVGTLLTNNTRLDLGKRILDPRGIY RCNGTDIYKD KESAVQVHYRMCQNCVELDPATLA
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      22 to 105
    • Tags

      DDDDK tag C-Terminus
    • Additional sequence information

      CD3 delta extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab200501 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilised from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilised protein in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD3 antigen delta subunit
    • CD3 delta
    • CD3d
    • CD3d antigen delta polypeptide (TiT3 complex)
    • CD3d molecule delta (CD3 TCR complex)
    • CD3e
    • CD3e antigen epsilon polypeptide (TiT3 complex)
    • CD3e molecule epsilon (CD3 TCR complex)
    • CD3E_HUMAN
    • IMD18
    • IMD19
    • OKT3 delta chain
    • T cell antigen receptor complex epsilon subunit of T3
    • T cell receptor T3 delta chain
    • T cell surface glycoprotein CD3 delta chain
    • T-cell surface antigen T3/Leu-4 epsilon chain
    • T-cell surface glycoprotein CD3 epsilon chain
    • T3D
    • T3E
    • TCRE
    see all
  • Function

    The CD3 complex mediates signal transduction.
  • Involvement in disease

    Immunodeficiency 18
  • Sequence similarities

    Contains 1 Ig-like (immunoglobulin-like) domain.
    Contains 1 ITAM domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • DTT-reduced SDS-PAGE analysis of ab200501 stained overnight with Coomassie Blue.

    DTT-reduced heterodimer protein migrates as 18-20 kDa and 25-40 kDa due to glyosylation.

References

ab200501 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200501.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up