Recombinant cynomolgus monkey Glypican 3 protein (Fc Chimera Active) (ab220548)
Key features and details
- Expression system: HEK 293 cells
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant cynomolgus monkey Glypican 3 protein (Fc Chimera Active)
See all Glypican 3 proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA. Immobilized Human FGF basic, Tag Free at 2 μg/ml (100 μl/well) can bind ab220548 with a linear range of 4.8-19.5 ng/ml.
-
Purity
90 % SDS-PAGE.
Purity 90% Glypican 3 and 2-8% human IgG1 Fc fragment as determined by SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Cynomolgus monkey -
Sequence
QPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGPTCCS RKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVRHAKN YTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSL FPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVSKSLQ VTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPC GGYCNVVMQGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLF STIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVLK VAHVEHEETLSSRRRELIQKLKSFISFYSALPGYICSHSPVAENDTLCWN GQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLR TMSVPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMMKVKNQLRFLA ELAYDLDVDDVPGNNQQATPKDNEISTFHNLGNVH -
Predicted molecular weight
88 kDa including tags -
Amino acids
25 to 559 -
Additional sequence information
Fused with a human IgG1 Fc tag (Pro 100 - Lys 330; UniProt P01857) at the C-terminus.
-
Specifications
Our Abpromise guarantee covers the use of ab220548 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.4
Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose
Lyophilized from 0.22 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 200 µg/ml.
General Info
-
Alternative names
- DGSX
- Glypican proteoglycan 3
- Glypican-3 [Precursor]
see all -
Function
Cell surface proteoglycan that bears heparan sulfate. Inhibits the dipeptidyl peptidase activity of DPP4. May be involved in the suppression/modulation of growth in the predominantly mesodermal tissues and organs. May play a role in the modulation of IGF2 interactions with its receptor and thereby modulate its function. May regulate growth and tumor predisposition. -
Tissue specificity
Highly expressed in lung, liver and kidney. -
Involvement in disease
Defects in GPC3 are the cause of Simpson-Golabi-Behmel syndrome type 1 (SGBS1) [MIM:312870]; also known as Simpson dysmorphia syndrome (SDYS). SGBS is a condition characterized by pre- and postnatal overgrowth (gigantism) with visceral and skeletal anomalies. -
Sequence similarities
Belongs to the glypican family. -
Cellular localization
Cell membrane and Secreted > extracellular space. - Information by UniProt
Images
-
Cynomolgus Glypican 3, Fc Tag on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 90%.
-
Immobilized Cynomolgus Glypican 3, Fc Tag at 0.5 µg/mL (100 µL/well) can bind Monoclonal Anti-Human GPC3 Antibody, Human IgG1 with a linear range of 0.2-3 ng/mL.
-
Immobilized Human FGF basic, Tag Free at 2 µg/mL (100 µL/well) can bind Cynomolgus Glypican 3, Fc Tag with a linear range of 1-31 ng/mL.
-
SDS-PAGE analysis of ab220548 stained overnight with Coomassie Blue.
The protein migrates as 100 kDa, 58 kDa, 40 kDa on a SDS-PAGE gel under reducing conditions due to glycosylation.
-
Immobilized Human FGF basic, Tag Free at 2 μg/ml (100 μl/well) can bind ab220548 with a linear range of 4.8-19.5 ng/ml.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab220548 has not yet been referenced specifically in any publications.