Recombinant cynomolgus monkey PD-L1 protein (Active) (ab221343)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant cynomolgus monkey PD-L1 protein (Active)
See all PD-L1 proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA. Immobilized ab221343 at 1 μg/mL (100 μL/well) can bind Anti-Human PD-L1 MAb with a linear range of 0.4-3 ng/mL.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Cynomolgus monkey -
Sequence
FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLTSLIVYWEMEDKNIIQFV HGEEDLKVQHSNYRQRAQLLKDQLSLGNAALRITDVKLQDAGVYRCMISY GGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWT SSDHQVLSGKTTTTNSKREEKLLNVTSTLRINTTANEIFYCIFRRLDPEE NHTAELVIPELPLALPPNER -
Predicted molecular weight
27 kDa including tags -
Amino acids
19 to 238 -
Tags
His tag C-Terminus -
Additional sequence information
In the region Phe 19 - Arg 238, the amino acid sequence of Cynomolgus and Rhesus macaque PD-L1 are homologus.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab221343 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 95% PBS, 5% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- B7 H
- B7 H1
- B7 homolog 1
see all -
Function
Involved in the costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNG, in an IL2-dependent and a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation and cytokine production. -
Tissue specificity
Highly expressed in the heart, skeletal muscle, placenta and lung. Weakly expressed in the thymus, spleen, kidney and liver. Expressed on activated T- and B-cells, dendritic cells, keratinocytes and monocytes. -
Sequence similarities
Belongs to the immunoglobulin superfamily. BTN/MOG family.
Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Cell membrane and Endomembrane system. - Information by UniProt
Images
-
Cynomolgus / Rhesus macaque PD-L1, His Tag (ab221343) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
-
Immobilized ab221343 at 1 μg/mL (100 μL/well) can bind Anti-Human PD-L1 MAb with a linear range of 0.4-3 ng/mL.
-
Anti-Human PD-L1 MAb captured on CM5 chip via anti-human IgG Fc antibody surface can bind ab221343 with an affinity constant of 23.3 nM as determined in a SPR assay (Biacore T200).
-
Loaded Anti-Human PD-L1 MAb (Human IgG1) on AHC Biosensor, can bind ab221343 with an affinity constant of 19.1 nM as determined in BLI assay (ForteBio Octet Red96e).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab221343 has not yet been referenced specifically in any publications.