Bioactive grade

Recombinant cynomolgus monkey TIGIT protein (Active) (ab223112)

Description

  • Product name

    Recombinant cynomolgus monkey TIGIT protein (Active)
    See all TIGIT proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus / Rhesus macaque TIGIT (ab223112) at 5 μg/mL (100 μL/well) can bind Human CD155 with a linear range of 0.078-2.5 μg/mL.

  • Purity

    > 90 % SDS-PAGE.
    Purity determined by SEC-HPLC.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Cynomolgus monkey
    • Sequence

      MMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRN AELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRG RIFLEVLESSVAEHSARFQI
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      89 to 208
    • Tags

      His tag C-Terminus
    • Additional sequence information

      In the region Met 89 - Ile 208, the AA sequence of Cynomolgus and Rhesus macaque TIGIT are homologus.

Specifications

Our Abpromise guarantee covers the use of ab223112 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage. No activity loss is observed after storage at: 4-8°C for 12 months in lyophilized state; -70°C for 3 months under sterile conditions after reconstitution.

General Info

  • Alternative names

    • DKFZp667A205
    • ENSMUSG00000071552
    • FLJ39873
    • RGD1563191
    • T cell immunoreceptor with Ig and ITIM domains
    • TIGIT
    • TIGIT_HUMAN
    • V-set and immunoglobulin domain containing 9
    • V-set and immunoglobulin domain-containing protein 9
    • V-set and transmembrane domain containing 3
    • V-set and transmembrane domain-containing protein 3
    • VSIG9
    • VSTM3
    • Washington University cell adhesion molecule
    • WUCAM
    see all
  • Function

    Binds with high affinity to the poliovirus receptor (PVR) which causes increased secretion of IL10 and decreased secretion of IL12B and suppresses T cell activation by promoting the generation of mature immunoregulatory dendritic cells.
  • Tissue specificity

    Expressed at low levels on peripheral memory and regulatory CD4+ T cells and NK cells and is up-regulated following activation of these cells (at protein level).
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain

    Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • Immobilized ab223112 at 5 μg/mL (100 μL/well) can bind Human CD155, Fc Tag (ab220561) with a linear range of 0.078-2.5 μg/mL

  • The purity of ab223112 was greater than 90% as determined by SEC-HPLC.

     
  • ab223112 was analysed by SDS-PAGE.

    The protein migrates as 20-23 kDa under reducing conditions due to glycosylation.

References

ab223112 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223112.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up