Recombinant Cytomegalovirus Envelope glycoprotein B (Tagged) (ab236276)

Description

  • Product name

    Recombinant Cytomegalovirus Envelope glycoprotein B (Tagged)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Cytomegalovirus
    • Sequence

      MRQKRAYEKPFEHFFPYVVPPTTVKEAPPSYEQSQYENIKEKAASATKEF SLEEAYQMLLALQKLDQEKRRKAEADDEDFASNGQSAGFLDRLRNRRRGG YQKIQNEYEV
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      745 to 854
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Rhesus cytomegalovirus (strain 68-1) (RhCMV). N-terminal 10xHis-tag. and C-terminal Myc-tag.

Specifications

Our Abpromise guarantee covers the use of ab236276 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab236276.

References

ab236276 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236276.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up