Description

  • Product name

    Recombinant Cytomegalovirus Glycoprotein B (Fc Chimera)
    See all Cytomegalovirus Glycoprotein B proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Cytomegalovirus
    • Sequence

      VSSSSTRGTSATHSHHSSHTTSAAHSRSGSVSQRVTSSQTVSHGVNETIY NTTLKYGDVVGVNTTKYPYRVCSMAQGTDLIRFERNIVCTSMKPINEDLD EGIMVVYKRNIVAHTFKVRVYQKVLTFRRSYAYIHTTYLLGSNTEYVAPP MWEIHHINSHSQCYSSYSRVIAGTVFVAYHRDSYENKTMQLMPDDYSNTH STRYVTVKDQWHSRGSTWLYRETCNLNCMVTITTARSKYPYHFFATSTGD VVDISPFYNGTNRNASYFGENADKFFIFPNYTIVSDFGRPNSALETHRLV AFLERADSVISWDIQDEKNVTCQLTFWEASERTIRSEAEDSYHFSSAKMT ATFLSKKQEVNMSDSALDCVRDEAINKLQQIFNTSYNQTYEKYGNVSVFE TTGGLVVFWQGIKQKSLVELERLANRSSLNLTHNRTKRSTDGNNATHLSN MESVHNLVYAQLQFTYDTLRGYINRALAQIAEAWCVDQRRTLEVFKELSK INPSAILSAIYNKPIAARFMGDVLGLASCVTINQTSVKVLRDMNVKESPG RCYSRPVVIFNFANSSYVQYGQLGEDNEILLGNHRTEECQLPSLKIFIAG NSAYEYVDYLFKRMIDLSSISTVDSMIALDIDPLENTDFRVLELYSQKEL RSSNVFDLEE IMREFNSYKQRVKYVEDK
    • Predicted molecular weight

      104 kDa including tags
    • Amino acids

      23 to 700
    • Additional sequence information

      Fc Chimera is fused with a Human IgG1 Fc tag at the C-terminus. The furin cleavage site is mutated from 'RTKR' to 'TTQT'.

Specifications

Our Abpromise guarantee covers the use of ab206020 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, L-Arginine, Sodium chloride, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CMV glycoprotein B
    • Glycoprotein B
    • HCMV
    • HHV5 glycoprotein B
    • UL55
    see all
  • Relevance

    Human cytomegalovirus (HCMV) glycoprotein B (gB) is an abundant virion envelope protein that has been shown to be essential for the infectivity of HCMV. HCMV gB is also one of the most immunogenic virus-encoded proteins, and a significant fraction of virus neutralizing antibodies are directed at gB.
  • Cellular localization

    Virus envelope.

Images

  • SDS-PAGE analysis of reduced ab206020, staining overnight with Coomassie Blue. DTT-reduced Protein migrates as 140-150 kDa in SDS-PAGE due to glycosylation.

References

ab206020 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206020.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up