Recombinant Diacylglycerol acyltransferase/mycolyltransferase Ag85B protein (Tagged) (ab236191)

Description

  • Product name

    Recombinant Diacylglycerol acyltransferase/mycolyltransferase Ag85B protein (Tagged)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      FSRPGLPVEYLQVPSAAMGRSIKVQFQSGGDNSPAVYLLDGLRAQDDYNG WDINTPAFEWYYQSGLSVIMPVGGQSSFYSDWYSPACGKAGCTTYKWETF LTSELPQWLSANRSVKPTGSAAVGISMAGSSALILSVYHPQQFIYAGSLS ALMDPSQGMGPSLIGLAMGDAGGYKASDMWGPSSDPAWQRNDPSLHIPEL VANNTRLWIYCGNGTPSELGGANVPAEFLENFVRSSNLKFQDAYNAAGGH NAVFNLDANGTHSWEYWGAQLNAMKGDLQASLGAR
    • Predicted molecular weight

      51 kDa including tags
    • Amino acids

      41 to 325
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Mycobacterium kansasii. This product is the mature full length protein from aa 41 to 325. The signal peptide is not included. N-terminal 10xHis-SUMO-tag and C-terminal Myc-tag.

Specifications

Our Abpromise guarantee covers the use of ab236191 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • •30 kDa extracellular protein
    • 85B
    • Acyl CoA diacylglycerol acyltransferase
    • Ag85B
    • Antigen 85 complex B
    • DGAT
    • Extracellular alpha antigen
    • fbpB
    • Fibronectin binding protein B
    see all

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab236191.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab236191 could indicate that this peptide derived from E.coli-expressed Mycobacterium kansasii Diacylglycerol acyltransferase/mycolyltransferase Ag85B.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab236191 could indicate that this peptide derived from E.coli-expressed Mycobacterium kansasii Diacylglycerol acyltransferase/mycolyltransferase Ag85B.

References

ab236191 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236191.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up