Recombinant DNA polymerase II large subunit protein (ab237792)

Overview

  • Product name

    Recombinant DNA polymerase II large subunit protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Sequence

      LAELKGAVQTGENKEDAAAKRMREVITGRSVLSMPNRLGGFRLRYGRACN TGYTSVGFHPAVAEILDHTIAVGTQVKIDIPGKGATVAFVDTIEAPTVRL AGGDVVKIRDVAHGIELKGSIERILHLGDMLISFGDFLENNAQLVPSGYV EEIWKMDMEAAGAAQGSPSSADEAVRISRELGVPLHPRYLYYWDQISHEE LAMLLSPLDKGDAISYPAACKPVLEKLGVPHKAGPEGPVLEGDEARIFRE LILDNPPGPDASAPVPELISRSSGITIRDKFSTSIGVRIGRPEKAAPRQM RPPTHCLFPVGGTGGPTNNLLKSAARPGFSADILSRRCPGCGEPSISIRC WACGERTAVERTCMQCGTDVDGEECERCGRPGLAHSRVEFPLKKMLVSAQ EKTGVRAHDPLKGVKELAHQDRIAEPLEKGLIRQSRSLTVFKDGTVRFDA TNSPMTHFKPSWIGTSAEKLRELGYETDVDGKKLEGPDQLVELRMQDIVI PLEGAKYLVSACGYIDAELDKLYGAPPFYKVPDLGGLIGHLVVGLA
    • Molecular weight

      59 kDa
    • Amino acids

      287 to 832
    • Additional sequence information

      Cenarchaeum symbiosum (strain A).

Specifications

Our Abpromise guarantee covers the use of ab237792 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab237792.

References

ab237792 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237792.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up