Recombinant DNA polymerase IV protein (ab238357)

Description

  • Product name

    Recombinant DNA polymerase IV protein
    See all DNA polymerase IV proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      MGNQKKIIHIDMDCFYAAIEMRDFPEYQNIPLAVGGDGPRSVLCTSNYQA RQFGVRSAMPAIKAKQLCPHLKIVHGRMDVYKETSKNIREIFSRYTDLIE PLSLDEAYLDVTDATMCQGSATLIAERIRADIFNELNLTASAGIAPNKFL AKIASDENKPNGQCVITPDKVANFVEQLSLKKIPGIGPKTFEKLNRHGYV TCADVRQSNIRALQNIVGKFANSLYLKSHGVDNRDLEVSRQRKSLAIETT LAHDISTQDECKLVIDSLYQKLLTRLAPHSNREIIRQGVKLKFTDFNQTT VETQSNECQQALFISLLSKAYSRSNKRGVRLVGLTLGFADSPGESQQLSL SL
    • Predicted molecular weight

      39 kDa
    • Amino acids

      1 to 352
    • Additional sequence information

      Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus).

Specifications

Our Abpromise guarantee covers the use of ab238357 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • dinB
    • Pol IV
  • Relevance

    Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by PolIV. Exhibits no 3'-5' exonuclease (proofreading) activity. May be involved in translesional synthesis, in conjunction with the beta clamp from PolIII.

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab238357.

References

ab238357 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238357.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up