Recombinant DNA polymerase IV protein (His tag) (ab238377)

Description

  • Product name

    Recombinant DNA polymerase IV protein (His tag)
    See all DNA polymerase IV proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      MGNQKKIIHIDMDCFYAAIEMRDFPEYQNIPLAVGGDGPRSVLCTSNYQA RQFGVRSAMPAIKAKQLCPHLKIVHGRMDVYKETSKNIREIFSRYTDLIE PLSLDEAYLDVTDATMCQGSATLIAERIRADIFNELNLTASAGIAPNKFL AKIASDENKPNGQCVITPDKVANFVEQLSLKKIPGIGPKTFEKLNRHGYV TCADVRQSNIRALQNIVGKFANSLYLKSHGVDNRDLEVSRQRKSLAIETT LAHDISTQDECKLVIDSLYQKLLTRLAPHSNREIIRQGVKLKFTDFNQTT VETQSNECQQALFISLLSKAYSRSNKRGVRLVGLTLGFADSPGESQQLSL SL
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      1 to 352
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus)

Specifications

Our Abpromise guarantee covers the use of ab238377 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • dinB
    • Pol IV
  • Relevance

    Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by PolIV. Exhibits no 3'-5' exonuclease (proofreading) activity. May be involved in translesional synthesis, in conjunction with the beta clamp from PolIII.

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel of ab238377.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab238377 could indicate that this peptide derived from E.coli-expressed Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus) dinB.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab238377 could indicate that this peptide derived from E.coli-expressed Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus) dinB.

References

ab238377 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238377.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up