Recombinant DNA protection during starvation protein (Tagged) (ab224850)

Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mycobacterium smegmatis
    • Sequence

      MTSFTIPGLSDKKASDVADLLQKQLSTYNDLHLTLKHVHWNVVGPNFIGV HEMIDPQVELVRGYADEVAERIATLGKSPKGTPGAIIKDRTWDDYSVERD TVQAHLAALDLVYNGVIEDTRKSIEKLEDLDLVSQDLLIAHAGELEKFQW FVRAHLESAGGQLTHEGQSTEKGAADKARRKSA
    • Molecular weight

      36 kDa including tags
    • Amino acids

      1 to 183
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Mycobacterium smegmatis protein with 6xHis-SUMO tag at the N-terminus.

Specifications

Our Abpromise guarantee covers the use of ab224850 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Bacterioferritin
    • dps
    • HP-NAP
    • NAP A
    • napA
    • Neutrophil-activating protein A
    see all
  • Relevance

    Function: Protects DNA from oxidative damage by sequestering intracellular Fe2+ ion and storing it in the form of Fe3+ oxyhydroxide mineral. One hydrogen peroxide oxidizes two Fe2+ ions, which prevents hydroxyl radical production by the Fenton reaction (By similarity). Required for the survival in the presence of oxidative stress. Dps is also a virulence factor that activates neutrophils, mast cells and monocytes. It binds to neutrophil-glycosphingolipids and to sulfated carbohydrates on mucin. It might have a role in the accumulation of neutrophils and monocytes at the site of infection. Induces superoxide anion generation, adhesion and chemotaxis of neutrophils, through a pertussis toxin-sensitive pathway involving MAP kinases.

Images

  • SDS-PAGE - Recombinant DNA protection during starvation protein (His tag) (ab224850) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab224850 with 5% enrichment gel and 15% separation gel.

References

ab224850 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224850.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up