Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Dog
    • Sequence

      HHHHHHGSGGSGPFGNTHNKFKLNYKPEEEYPDLTKHNNHMAKALTPEIY KKLRDKETPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYQVFKDLF DPIIQDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKG YTLPPHCSRGERRAVEKLSIEALNSLTGEFKGKYYPLKSMTEQEQQQLID DHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVIS MQKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGT GLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDISNA DRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
    • Molecular weight

      44 kDa including tags
    • Amino acids

      2 to 381
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 2 to 381. The initiator methionine is not included.

Specifications

Our Abpromise guarantee covers the use of ab197789 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Sandwich ELISA

    Western blot

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

    Product was previously marketed under the MitoSciences sub-brand.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 0.03% EDTA, 10% Trehalose, 89% PBS

General Info

  • Alternative names

    • CKM
    • CKMM
    • Creatine kinase M
    • Creatine kinase M chain
    • Creatine kinase M type
    • Creatine kinase M-type
    • Creatine kinase muscle
    • Creatine kinase, muscle type
    • KCRM_HUMAN
    • M-CK
    • MCK
    • Muscle creatine kinase
    see all
  • Function

    Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.
  • Sequence similarities

    Belongs to the ATP:guanido phosphotransferase family.
    Contains 1 phosphagen kinase C-terminal domain.
    Contains 1 phosphagen kinase N-terminal domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • Anti-Creatine Kinase MM antibody [3E5BA5] (ab110319) at 1 µg/ml + Recombinant Dog Creatine Kinase MM protein (ab197789) at 0.1 µg

    Secondary
    HRP conjugated Goat anti-mouse IgG (H&L) at 1/5000 dilution

    Developed using the ECL technique.

    Exposure time: 5 minutes


    Samples run on a 4-20% acrylamide gel, performed under reducing conditions and developed using the ECL technique.

    Membrane was blocked with 5% Milk in PBS, Primary antibody was incubated in 1% Milk in PBS and secondary antibody was incubated in 1X Blocking buffer (ab126587).

     

    Predicted CKM band size: 43.1 kDa
    Observed CKM band size: 43 kDa

  • Example of canine CKM protein performance when ran in an ELISA (Canine CKM SimpleStep ELISA, ab197749).

References

ab197789 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197789.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up