Description

  • Product name

    Recombinant Dog EPO protein
    See all EPO proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab209171 is purified by Ion Exchange Chromatography.
  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Dog
    • Sequence

      APPRLICDSRVLERYILEAREAENVTMGCAQGCSFSENITVPDTKVNFYT WKRMDVGQQALEVWQGLALLSEAILRGQALLANASQPSETPQLHVDKAVS SLRSLTSLLRALGAQKEAMSLPEEASPAPLRTFTVDTLCKLFRIYSNFLR GKLTLYTGEACRRGDR
    • Predicted molecular weight

      18 kDa
    • Amino acids

      41 to 206
    • Additional sequence information

      This product is the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab209171 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Lyophilised
  • Additional notes

    ab209171 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

    Constituents: 10% Trehalose, 90% PBS

  • Reconstitution
    Reconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein.

General Info

  • Alternative names

    • EP
    • EPO
    • EPO alpha
    • Epoetin
    • Erythropoetin
    • Erythropoietin precursor
    • MVCD2
    see all
  • Relevance

    Human erythropoietin is member of the EPO/TPO family and encodes a secreted, glycosylated cytokine hormone composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types. It is produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals.
  • Cellular localization

    Secreted

References

ab209171 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab209171.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up