Overview

Description

  • Nature

    Recombinant
  • Source

    Yeast
  • Amino Acid Sequence
    • Accession
    • Species

      Dog
    • Sequence

      APTRSPTLVTRPSQHVDAIQEALSLLNNSNDVTAVMNKAVKVVSEVFDPE GPTCLETRLQLYKEGLQGSLTSLKNPLTMMANHYKQHCPPTPESPCATQN INFKSFKENLKDFLFNIPFDCWKPVKK
    • Molecular weight

      14 kDa
    • Amino acids

      18 to 144
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab209121 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The biological activity of ab209121 was measured in a cell proliferation assay using the human TF-1 cell line. The ED50 for this effect is typically 25 - 45 ng/mL.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity

    > 95 % SDS-PAGE.
    Purified by ion-exchange chromatography.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituents: 10% Trehalose, 90% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with sterile PBS containing at least 0.1% carrier protein.

General Info

  • Alternative names

    • Colony stimulating factor
    • Colony Stimulating Factor 2
    • Colony stimulating factor 2 (granulocyte-macrophage)
    • Colony-stimulating factor
    • CSF
    • CSF 2
    • CSF2
    • CSF2_HUMAN
    • GM-CSF
    • GMCSF
    • Granulocyte Macrophage Colony Stimulating Factor
    • Granulocyte-macrophage colony-stimulating factor
    • MGC131935
    • MGC138897
    • MGI1GM
    • Molgramostin
    • Pluripoietin-a
    • Sargramostim
    see all
  • Function

    Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
  • Sequence similarities

    Belongs to the GM-CSF family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab209121 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab209121.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up