Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Dog
    • Sequence

      MAPTRSPTLVTRPSQHVDAIQEALSLLNNSNDVTAVMNKAVKVVSEVFDP EGPTCLETRLQLYKEGLQGSLTSLKNPLTMMANHYKQHCPPTPESPCATQ NINFKSFKENLKDFLFNIPFDCWKPVKK
    • Molecular weight

      14 kDa
    • Amino acids

      18 to 144
    • Additional sequence information

      This product is the mature full length protein from aa 18 to 144. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab233684 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    TF-1 cell proliferation: ED50 ≤ 15 ng/ml ( ≥ 6.7 x 104 units/mg).

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    >= 95 % SDS-PAGE.
    Produced using animal-free processes and contains only animal-free raw materials.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    pH: 7.50
    Constituent: 0.16% Sodium phosphate

    Lyophilized from a sterile (0.2 micron) filtered aqueous solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with sterile water at 0.1 mg/ml. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

General Info

  • Alternative names

    • Colony stimulating factor
    • Colony Stimulating Factor 2
    • Colony stimulating factor 2 (granulocyte-macrophage)
    • Colony-stimulating factor
    • CSF
    • CSF 2
    • CSF2
    • CSF2_HUMAN
    • GM-CSF
    • GMCSF
    • Granulocyte Macrophage Colony Stimulating Factor
    • Granulocyte-macrophage colony-stimulating factor
    • MGC131935
    • MGC138897
    • MGI1GM
    • Molgramostin
    • Pluripoietin-a
    • Sargramostim
    see all
  • Function

    Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.
  • Sequence similarities

    Belongs to the GM-CSF family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab233684 induced proliferation of TF-1 cells.

  • 1 µg ab233684 analyzed on a 4-20% Tris-Glycine gel, stained with Coomassie Blue.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

References

ab233684 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233684.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up