Description

  • Product name

    Recombinant Dog IL-18 protein (His tag)
    See all IL-18 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Dog
    • Sequence

      YFGKLEPKLSIIRNLNDQVLFVNEGNQPVFEDMPDSDCTDNAPHTIFIIY MYKDSLTRGLAVTISVKYKTMSTLSCKNKTISFQKMSPPDSINDEGNDII FFQRSVPGHDDKIQFESSLYKGHFLACKKENDLFKLILKDKDENGDKSIM FTVQNKS
    • Predicted molecular weight

      22 kDa including tags
    • Amino acids

      37 to 193
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 37 to 193. The propeptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab225983 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Iboctadekin
    • IFN gamma inducing factor
    • IFN-gamma-inducing factor
    • IGIF
    • IL 1 gamma
    • IL 18
    • IL 1g
    • IL-1 gamma
    • IL-18
    • IL1 gamma
    • IL18
    • IL18 protein
    • IL18_HUMAN
    • IL1F4
    • IL1g
    • IL1gamma
    • ILIF4
    • Interferon gamma inducing factor
    • Interferon gamma-inducing factor
    • Interleukin 1 gamma
    • Interleukin 18
    • Interleukin 18 (interferon-gamma-inducing factor)
    • Interleukin-1 gamma
    • Interleukin-18
    • Interleukin18
    • MGC12320
    see all
  • Function

    Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.
  • Sequence similarities

    Belongs to the IL-1 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab225983 with 5% enrichment gel and 15% separation gel.

References

ab225983 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225983.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up