Description

  • Product name

    Recombinant dog IL-3 protein
    See all IL-3 proteins and peptides
  • Biological activity

    The ED50 as determined by the dose-dependant stimulation of the proliferation of Human TF-1 cells is less than 0.2 ng/ml, corresponding to a specific activity of 5.0×106 IU/mg.

  • Purity

    > 97 % SDS-PAGE.
    > 97 % by HPLC.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Dog
    • Sequence

      RPFSTDLPKQYFTMINEIMEMLNKSPSPSEEPLDSNEKETLLEDTLLRPN LDVFLNASSKFHKNGLLIWNNLKEFLPLLPTPTPRGEPISIMENNWGDFQ RKLKKYLEALDNFLNFKNKP
    • Predicted molecular weight

      14 kDa
    • Amino acids

      24 to 143
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab201436 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.

General Info

  • Alternative names

    • Colony stimulating factor multiple
    • Hematopoietic growth factor
    • IL 3
    • IL-3
    • IL3
    • IL3_HUMAN
    • Interleukin 3
    • Interleukin 3 (colony stimulating factor, multiple)
    • Interleukin-3
    • Mast cell growth factor
    • MCGF
    • MGC79398
    • MGC79399
    • Multi CSF
    • Multilineage colony stimulating factor
    • Multipotential colony stimulating factor
    • Multipotential colony-stimulating factor
    • OTTHUMP00000065963
    • P cell stimulating factor
    • P-cell-stimulating factor
    see all
  • Function

    Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.
    This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.
  • Tissue specificity

    Activated T-cells, mast cells, natural killer cells.
  • Sequence similarities

    Belongs to the IL-3 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab201436 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201436.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up