Description

  • Product name

    Recombinant dog IL-5 protein
    See all IL-5 proteins and peptides
  • Biological activity

    The biological activity of recombinant canine IL-5 was measured in a cell proliferation assay using the human TF-1 cell line. The ED50 for this effect is typically 55 - 85 ng/mL.

  • Purity

    > 95 % SDS-PAGE.
    Purified by Ion-exchange chromatography.
  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Dog
    • Sequence

      VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGI DTLKNQTAHGEAVDKLFQNLSLIKEHIERQKKRCAGERWRVTKFLDYLQV FLGVINTEWTPES
    • Predicted molecular weight

      13 kDa
    • Amino acids

      22 to 134
    • Additional sequence information

      This product is the mature full length protein from aa 22 to 134. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab90799 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Reconstituted protein is stable for at least 3 months when stored in working aliquots with a carrier protein at -20°C. Avoid repeated freeze/thaw cycles.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C. Avoid freeze / thaw cycle. Stable for 12 months at -20°C. Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C..

    Constituents: 10% Trehalose, 90% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein.

General Info

  • Alternative names

    • B-cell differentiation factor I
    • Colony stimulating factor
    • EDF
    • Eosinophil differentiation factor
    • IL-5
    • IL5
    • IL5_HUMAN
    • Interleukin 5
    • Interleukin 5 (colony stimulating factor, eosinophil)
    • Interleukin-5
    • T Cell Replacing Factor
    • T-cell replacing factor
    • TRF
    see all
  • Function

    Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells.
  • Sequence similarities

    Belongs to the IL-5 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab90799 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab90799.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up