Description

  • Product name

    Recombinant dog IL-8 protein
    See all IL-8 proteins and peptides
  • Biological activity

    The biological activity was determined by a chemotaxis bioassay using Human CXCR2 transfected murine BaF3 cells is in a concentration range of 0.15-0.75 ng/ml.

  • Purity

    > 95 % SDS-PAGE.
    ab200269 is > 95 % pure as assessed by SDS-PAGE and HPLC analyses.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Dog
    • Sequence

      AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFN GNEVCLDPKEKWVQKVVQIFLKKAEKQDP
    • Predicted molecular weight

      9 kDa
    • Amino acids

      23 to 101
    • Additional sequence information

      This product is for the mature full length protein from aa 23 to 101. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab200269 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.4

    Lyophilized from a 0.2 um filtered concentrated solution in 2 × PBS.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.

General Info

  • Alternative names

    • (Ala-IL-8)77
    • (Ser-IL-8)72
    • 9E3
    • Beta thromboglobulin like protein
    • C-X-C motif chemokine 8
    • CEF-4
    • chemokine, CXC motif, ligand 8
    • CXCL8
    • Emoctakin
    • GCP-1
    • GCP/IL-8 protein I
    • GCP/IL-8 protein II
    • GCP/IL-8 protein III
    • GCP/IL-8 protein IV
    • GCP/IL-8 protein V
    • GCP/IL-8 protein VI
    • GCP1
    • Granulocyte chemotactic protein 1
    • IL-8
    • IL-8(1-77)
    • IL-8(9-77)
    • IL8
    • IL8/NAP1 form I
    • IL8/NAP1 form II
    • IL8/NAP1 form III
    • IL8/NAP1 form IV
    • IL8/NAP1 form V
    • IL8/NAP1 form VI
    • IL8_HUMAN
    • Inteleukin 8
    • LECT
    • LUCT
    • Lymphocyte-derived neutrophil-activating factor
    • LYNAP
    • MDNCF
    • MDNCF-b
    • MDNCF-c
    • MONAP
    • Monocyte derived neutrophil activating peptide
    • Monocyte derived neutrophil chemotactic factor
    • Monocyte-derived neutrophil chemotactic factor
    • Monocyte-derived neutrophil-activating peptide
    • NAF
    • NAP 1
    • NAP-1
    • NAP1
    • Neutrophil activating peptide 1
    • Neutrophil activating protein 1
    • Neutrophil-activating factor
    • Neutrophil-activating protein 1
    • Protein 3 10C
    • Protein 3-10C
    • SCYB 8
    • SCYB8
    • Small inducible cytokine subfamily B member 8
    • T cell chemotactic factor
    • T-cell chemotactic factor
    • TSG 1
    • TSG1
    see all
  • Function

    IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Post-translational
    modifications

    Several N-terminal processed forms are produced by proteolytic cleavage after secretion from at least peripheral blood monocytes, leukcocytes and endothelial cells. In general, IL-8(1-77) is referred to as interleukin-8. IL-8(6-77) is the most promiment form.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab200269 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200269.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up