Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Dog
    • Sequence
      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFKDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDH LVPRGSGSGIQKKSRSVMAVTADDN VKDYLE CSLSKSYSSSSNTLGIDLWRGRRCCSGNLQLPPLAQRQSERARTPEGDGI SRPTTLPLMTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSSGLVLH ATFPGHSQRRESFLYRSDSDYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQ VLASLRSVRNNFTVLTNLHGASNKRSPAATSQPPVSRVNLQEESYQKLAM ETLEELDWCLDQLETIQTYRSVSEMASNKFKRMLNRELTHLSEMSRSGNQ VSEYISNTFLDKQNDVEIPSPTQKDREKKKKQQLMTQISGVKKLMHSSSL NNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSHNRPLTCIMYA IFQERDLLKTFKISSDTFVTYMMTLEDHYHSDVAYHNSLHAADVAQSTHV LLSTPALDAVFTDLEILATIFAAAIHDVDHPGVSNQFLINTNSELALMYN DESVLENHHLAVGFKLLQEEHCDIFQNLTKKQRQTLRKMVIDMVLATDMS KHMSLLADLKTMVETKKVTSSGVLL LDNYTDRIQVLRNMVHCADLSNP TKSLELYRQWTDRIMEEFFQQGDKERER GMEISPMCDKHTASVEKSQV GFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQSPSPPLDE QNRDCQGLMEKFQFELTLEEEDSEGPDKEGEGHNYFSSTKTLCVIDPEHR DSLGDTDGDTGAENKTPID
    • Molecular weight
      110 kDa including tags
    • Amino acids
      2 to 737
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab198483 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific activity: ≥ 3882 pmol/min/µg


    Unit Definition: One unit is defined as the amount of enzyme that will convert 1 pmole of 3, 5-cAMP to 5-AMP per minute at 37°C.


    Assay Conditions: 10 mM Tris-HCl, pH 7.4, 10 mM MgCl2, 0.1 mg/ml BSA, 0.05% Tween-20, 200 µM cAMP, 2.5 kU 5'-nucleotidase, and serial dilutions of ab198483 at 37°C for 20 min. Quantified by 5'- nucleotidase cleaving the 5' -AMP product and releasing the phosphate group which is detected by Malachite Green Reagent.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    >= 50 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 20% Glycerol, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • 5''-cyclic phosphodiesterase 4B
    • cAMP-specific 3''
    • cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    • cAMP-specific phosphodiesterase-4 B isoform
    • DKFZp686F2182
    • DPDE4
    • dunce-like phosphodiesterase E4
    • MGC126529
    • OTTHUMP00000010652
    • OTTHUMP00000010653
    • OTTHUMP00000010654
    • OTTHUMP00000010656
    • OTTHUMP00000232365
    • PDE 4B
    • PDE IVB
    • PDE32
    • Pde4b
    • PDE4B_HUMAN
    • PDE4B5
    • PDEIVB
    • Phosphodiesterase 4B
    • Phosphodiesterase 4B cAMP specific
    • Phosphodiesterase 4B, cAMP specific (phosphodiesterase E4 dunce homolog, Drosophila)
    see all
  • Function
    Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May be involved in mediating central nervous system effects of therapeutic agents ranging from antidepressants to antiasthmatic and anti-inflammatory agents.
  • Tissue specificity
    Expressed in brain, heart, lung and skeletal muscle.
  • Pathway
    Purine metabolism; 3',5'-cyclic AMP degradation; AMP from 3',5'-cyclic AMP: step 1/1.
  • Sequence similarities
    Belongs to the cyclic nucleotide phosphodiesterase family. PDE4 subfamily.
  • Information by UniProt

Images

  • Specific activity analysis of ab198483.

  • 4-20% SDS PAGE analysis of ab198483 (2 μg).

References

ab198483 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198483.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up