Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Dog
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMTDYGEEQRNELEALESIYPDSFTVLS ENPPSFTITVTSEAGENDETVQTTLKFTYSEKYPDEAPLYEIFSQENLED NDVSDILKLLALQAEENLGMVMIFTLVTAVQEKLNEIVDQIKTRREEEKK QKEKEAEEAEKQLFHGTPVTIENFLNWKAKFDAELLEIKKKRMKEEEQAG KNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQEMDDLELEDDE DDPDYNPADPESDSAD
    • Molecular weight

      30 kDa including tags
    • Amino acids

      1 to 243
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab139198 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 85 % SDS-PAGE.
    ab139198 is purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.03% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • CGI 24
    • DFRP2
    • DRG family regulatory protein 2
    • DRG family-regulatory protein 2
    • PTD013
    • RWD domain containing 1
    • RWD domain containing protein 1
    • RWD domain-containing protein 1
    • Rwdd1
    • RWDD1_HUMAN
    see all
  • Function

    Protects DRG2 from proteolytic degradation.
  • Sequence similarities

    Belongs to the RWDD1/GIR2 family.
    Contains 1 RWD domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab139198.

References

ab139198 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139198.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up