Description

  • Product name

    Recombinant Dolphin IL-10 protein
    See all IL-10 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab209174 is purified by Ion Exchange Chromatography.
  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Dolphin
    • Sequence

      GQHQGTQAKDSCIHFPDSLPHMLRELRAAFSSVKTFFQMNDQLDNSLLSQ SLLEDFKGYLGCQALSEMIQFYLEEVMPKAEDHGPNIKEHVNSLGEKLKT LRLQLRRCHRFLPCENKSKAVEQVKSVFNKLQEKGVYKAMSEFDIFINYI EAYMITKMKN
    • Predicted molecular weight

      19 kDa
    • Amino acids

      19 to 158
    • Additional sequence information

      Tursiops truncatus (Atlantic bottle-nosed dolphin) . This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab209174 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    ab209174 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

    Constituents: 10% Trehalose, 90% PBS

  • Reconstitution
    Reconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein.

General Info

  • Alternative names

    • CSIF
    • Cytokine synthesis inhibitory factor
    • GVHDS
    • IL 10
    • IL-10
    • IL10
    • IL10_HUMAN
    • IL10A
    • Interleukin 10
    • Interleukin-10
    • MGC126450
    • MGC126451
    • T-cell growth inhibitory factor
    • TGIF
    see all
  • Function

    Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.
  • Tissue specificity

    Produced by a variety of cell lines, including T-cells, macrophages, mast cells and other cell types.
  • Sequence similarities

    Belongs to the IL-10 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab209174 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab209174.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up