Recombinant E. coli Beta-lactamase CTX-M-1 protein (His tag) (ab226272)

Overview

  • Product name

    Recombinant E. coli Beta-lactamase CTX-M-1 protein (His tag)
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Escherichia coli
    • Sequence

      QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVM AVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAA ALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPG DPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGL PASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRD VLASAAKIVTNGL
    • Molecular weight

      32 kDa including tags
    • Amino acids

      29 to 291
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Strain K12. This product is the mature full length protein from aa 29 to 291. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab226272 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • bla

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226272 with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab226272 could indicate that this peptide derived from E.coli-expressed Escherichia coli Beta-lactamase CTX-M-1.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab226272 could indicate that this peptide derived from E.coli-expressed Escherichia coli Beta-lactamase CTX-M-1.

References

ab226272 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226272.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up