Description

  • Product name

    Recombinant E. coli BirA protein
    See all BirA proteins and peptides
  • Biological activity

    BirA (16 µg/mL) completely biotinlabels 10 µM of Avi-tag substrate at 30°C for 30 minutes in reaction buffer containing 50 mM Bicine pH 8.3, 10 mM ATP, 10 mM MgOAc, and 50 µM dBiotin.

  • Purity

    >= 78 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Escherichia coli
    • Sequence

      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLVPRGSKDNTVPLKLIALLANGEFHSGEQL GETLGMSRAAINKHIQTLRDWGVDVFTVPGKGYSLPEPIQLLNAKQILGQ LDGGSVAVLPVIDSTNQYLLDRIGELKSGDACIAEYQQAGRGRRGRKWFS PFGANLYLSMFWRLEQGPAAAIGLSLVIGIVMAEVLRKLGADKVRVKWPN DLYLQDRKLAGILVELTGKTGDAAQIVIGAGINMAMRRVEESVVNQGWIT LQEAGINLDRNTLAAMLIRELRAALELFEQEGLAPYLSRWEKLDNFINRP VKLIIGDKEIFGISRGIDKQGALLLE QDGIIKPWMGGEISLRSAEK
    • Predicted molecular weight

      61 kDa including tags
    • Amino acids

      2 to 321
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab198449 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Conjugation

    Purification

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Useful for covalently biotin-labeling of acceptor proteins for detection and purification assays. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol, 0.05% DTT, 0.49% Glutathione

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Bifunctional protein birA
    • Bio R
    • BioR
    • Biotin [acetyl CoA carboxylase] synthetase
    • Biotin ligase
    • Biotin operon repressor
    • Biotin protein ligase
    • Bir A
    • BirA bifunctional protein
    • Dhb B
    • dhbB
    see all
  • Relevance

    BirA acts both as a biotin-operon repressor and as the enzyme that synthesizes the corepressor, acetyl-CoA:carbon-dioxide ligase. This protein also activates biotin to form biotinyl-5'-adenylate and transfers the biotin moiety to biotin-accepting proteins.

Images

  • Image A: SDS-PAGE with Coomassie blue showing:

     

    Lane 1: Unbiotinylated BirA

    Lane 2: ab198449

    Lane 3: BRD4-Avi-biotin control

    Lane 4: Protein markers

     

    Image B. Shows the corresponding Western blot probed with Streptavidin-HRP and developed with ECL reagent.

  • 10% SDS-PAGE with Coomassie staining: 4 µg ab198449.

References

ab198449 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198449.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up