Recombinant E. coli Carbonic anhydrase 2/CA2 protein (ab208309)

Description

  • Product name

    Recombinant E. coli Carbonic anhydrase 2/CA2 protein
    See all Carbonic anhydrase 2/CA2 proteins and peptides
  • Biological activity

    Specific activity is > 1,000 pmol/min/ug, and is defined as the amount of enzyme that hydrolyze 1.0 pmole of 4-nitrophenyl acetate to 4-nitrophenol per minute at pH 7.5 at 37C.

  • Purity

    > 95 % SDS-PAGE.
    ab208309 was purified by conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Escherichia coli
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMKDIDTLISNNALWSKMLVEEDPGFFEKLA QAQKPRFLWIGCSDSRVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSV VQYAVDVLEVEHIIICGHYGCGGVQAAVENPELGLINNWLLHIRDIWFKH SSLLGEMPQERRLDTLCELNVMEQVYNLGHSTIMQSAWKRGQKVTIHGWA YGIHDGLLRDLDVTATNRETLEQRYRHGISNLKLKHANHK
    • Predicted molecular weight

      27 kDa including tags
    • Amino acids

      1 to 220
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_414668

Specifications

Our Abpromise guarantee covers the use of ab208309 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.02% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • CA 2
    • CA II
    • CA-II
    • Ca2
    • CAC
    • CAH2_HUMAN
    • CAII
    • Car 2
    • Car2
    • Carbonate dehydratase II
    • Carbonic anhydrase 2
    • Carbonic anhydrase B
    • Carbonic anhydrase C
    • Carbonic anhydrase C, formerly
    • Carbonic anhydrase II
    • Carbonic dehydratase
    • epididymis luminal protein 76
    • Epididymis secretory protein Li 282
    • HEL-76
    • HEL-S-282
    see all
  • Function

    Essential for bone resorption and osteoclast differentiation (By similarity). Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea. Involved in the regulation of fluid secretion into the anterior chamber of the eye.
  • Involvement in disease

    Defects in CA2 are the cause of osteopetrosis autosomal recessive type 3 (OPTB3) [MIM:259730]; also known as osteopetrosis with renal tubular acidosis, carbonic anhydrase II deficiency syndrome, Guibaud-Vainsel syndrome or marble brain disease. Osteopetrosis is a rare genetic disease characterized by abnormally dense bone, due to defective resorption of immature bone. The disorder occurs in two forms: a severe autosomal recessive form occurring in utero, infancy, or childhood, and a benign autosomal dominant form occurring in adolescence or adulthood. Autosomal recessive osteopetrosis is usually associated with normal or elevated amount of non-functional osteoclasts. OPTB3 is associated with renal tubular acidosis, cerebral calcification (marble brain disease) and in some cases with mental retardation.
  • Sequence similarities

    Belongs to the alpha-carbonic anhydrase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab208309.

References

ab208309 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab208309.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up