Description

  • Product name

    Recombinant E. coli cysH protein
  • Purity

    > 90 % SDS-PAGE.
    ab106888 was purified using conventional chromatography techniques
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Escherichia coli
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSKLDLNALNELPKVDRILALAETNAELEK LDAEGRVAWALDNLPGEYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTG YLFPETYRFIDELTDKLKLNLKVYRATESAAWQEARYGKLWEQGVEGIEK YNDINKVEPMNRALKELNAQTWFAGLRREQSGSRANLPVLAIQRGVFKVL PIIDWDNRTIYQYLQKHGLKYHPLWDEGYLSVGDTHTTRKWEPGMAEEET RFFGLKRECGLHEG
    • Predicted molecular weight

      30 kDa including tags
    • Amino acids

      1 to 244
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106888 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol, 0.29% Sodium chloride

General Info

  • Alternative names

    • 3' phosphoadenosine 5' phosphosulfate reductase
    • ECK2757
    • JW2732
  • Relevance

    CysH (Phosphoadenosine phosphosulfate reductase) belongs to the PAPS reductase family, specifically those acting on a sulfur group of donors with a disulfide as acceptor. Three substrates of this enzyme are adenosine 3',5'-bisphosphate, sulfite, and thioredoxin disulfide, whereas its two products are 3'-phosphoadenylyl sulfate and thioredoxin.
  • Cellular localization

    Cytoplasm

Images

  • 15% SDS-PAGE analysis of 3 µg ab106888.

References

ab106888 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab106888.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up