Description

  • Product name

    Recombinant E. coli deoC protein
  • Purity

    > 95 % SDS-PAGE.
    ab106864 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Escherichia coli
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMTDLKASSLRALKLMDLTTLNDDDTDEKVI ALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGN DDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACA AANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPE SARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADA RHYRFGASSLLASLLKALGHGDGKSASSY
    • Predicted molecular weight

      30 kDa including tags
    • Amino acids

      1 to 259
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106864 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0308% DTT, 0.316% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • 2 deoxyribose 5 phosphate aldolase
    • 2 deoxyribose 5 phosphate aldolase NAD(P) linked
    • 2-deoxy-D-ribose 5-phosphate aldolase
    • deoC
    • DEOC_ECOLI
    • Deoxyriboaldolase
    • Deoxyribose-phosphate aldolase
    • DERA
    • dra
    • Phosphodeoxyriboaldolase
    • thyR
    see all
  • Function

    Catalyzes a reversible aldol reaction between acetaldehyde and D-glyceraldehyde 3-phosphate to generate 2-deoxy-D-ribose 5-phosphate.
  • Pathway

    Carbohydrate degradation; 2-deoxy-D-ribose 1-phosphate degradation; D-glyceraldehyde 3-phosphate and acetaldehyde from 2-deoxy-alpha-D-ribose 1-phosphate: step 2/2.
  • Sequence similarities

    Belongs to the DeoC/FbaB aldolase family. DeoC type 2 subfamily.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab106864.

References

ab106864 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab106864.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up