Description

  • Product name

    Recombinant E. coli Disulfide-bond isomerase protein
    See all Disulfide-bond isomerase proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab229511 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Escherichia coli
    • Sequence

      MDDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQG PMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCG YCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAF DDVMAGKSVAPASCDVDIADHYALGVQLGVSGTPAVVLSNGTLVPGYQPP KEMKEFLDEHQKMTSGK
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      21 to 236
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 21 to 236. The signal peptide is not included (NP_417369).

Specifications

Our Abpromise guarantee covers the use of ab229511 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.32% Tris HCl, 0.06% EDTA

General Info

  • Alternative names

    • ECK2888
    • JW2861
    • Protein disulfide isomerase II
    • Thiol:disulfide interchange protein dsbC
    • XprA
    see all
  • Relevance

    Dsb proteins (DsbA, DsbB, DsbC, and DsbD) catalyze formation and isomerization of protein disulfide bonds in the periplasm of Escherichia coli. Disulphide bond isomerase (DsbC), a member of the thioredoxin superfamily, acts as a disulfide isomerase and converts aberrant disulfide bonds to correct ones. It also acts by transferring its disulfide bond to other proteins and is reduced in the process. DsbC is reoxidized by a yet uncharacterized protein.
  • Cellular localization

    Periplasm

Images

  • 15% SDS-PAGE analysis of 3 µg ab229511.

References

ab229511 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229511.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up