Recombinant E. coli DnaJ protein (ab168064)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      AKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIK EAYEVLTDSQKRAAYDQYGHAAFEQGGMGGGGFGGGADFSDIFGDVFGDI FGGGRGRQRAARGADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSG AKPGTQPQTCPTCHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCNKCH GHGRVERSKTLSVKIPAGVDTGDRIRLAGEGEAGEHGAPAGDLYVQVQVK QHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDGRVKLKVPGETQTGK LFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNERQKQLLQELQESFGGP TGEHNSPRSKSFFDGVKKFFDDLTR
    • Molecular weight
      41 kDa
    • Amino acids
      2 to 376

Specifications

Our Abpromise guarantee covers the use of ab168064 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Purity
    >= 99 % .

  • Form
    Liquid
  • Additional notes
    For maximum product recovery after thawing, centrifuge the vial before opening the cap.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.20
    Constituents: 0.89% Potassium chloride, 0.71% HEPES, 4% Glycerol, 0.09% Sodium chloride

General Info

  • Alternative names
    • Chaperone Hsp40 co chaperone with DnaK
    • Chaperone protein dnaJ
    • ECK0015
    • faa
    • groP
    • grpC
    • Heat shock protein J
    • HSP40
    • JW0014
    see all
  • Relevance
    The E. coli heat-shock protein DnaJ has been implicated in protein folding and protein complex dissociation. DnaJ, Heat shock protein, functions in association with DnaK(Hsp70) molecular chaperone to facilitate protein folding. p70 chaperone. DnaJ plays a key role in the chaperone reaction by stimulating the ATPase activity and activating the substrate binding of Hsp70. DnaJ consists of four domains that are N-terminal 76 amino acid J-domain, G/F domain, zinc-binding cystein rich CR-domain, C-terminal CTD-domain and they are conserved to various degrees among the homologues.
  • Cellular localization
    Cytoplasmic

References

ab168064 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168064.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up