Recombinant E. coli E. coli heat labile toxin A protein (Tagged) (ab236935)

Description

  • Product name

    Recombinant E. coli E. coli heat labile toxin A protein (Tagged)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Escherichia coli
    • Sequence

      NGDRLYRADSRPPDEIKRSGGLMPRGHNEYFDRGTQMNINLYDHARGTQT GFVRYDDGYVSTSLSLRSAHLAGQSILSGYSTYYIYVIATAPNMFNVNDV LGVYSPHPYEQEVSALGGIPYSQIYGWYRVNFGVIDERLHRNREYRDRYY RNLNIAPAEDGYRLAGFPPDHQAWREEPWIHHAPQGCGNSSRTITGDTCN EETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL
    • Predicted molecular weight

      33 kDa including tags
    • Amino acids

      19 to 258
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 10xHis-tagged and C-terminal Myc-tagged. Full length mature chain without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab236935 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • eltA
    • Escherichia coli
    • Heat labile enterotoxin A subunit
    • LTP A
  • Relevance

    E. coli is the head of the large bacterial family, Enterobacteriaceae, the enteric bacteria, which are faculatively anaerobic Gram negative rods that live in the intestinal tracts of animals in health and disease. Pili are macromolecular structures that allow binding to a digalactoside receptor in the urinary tract. Escherichia coli heat-labile enterotoxin is a close relative of cholera toxin. The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab236935.

References

ab236935 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236935.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up