Description

  • Product name

    Recombinant E. coli Ecotin protein
    See all Ecotin proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab103303 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Escherichia coli
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMAESVQPLEKIAPYPQAEKGMKRQVIQLTP QEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSS PVSTMMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRV WKAEEKIDNAVVR
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      21 to 162
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103303 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

    Previously labelled as E. coli serine protease inhibitor. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol, 0.29% Sodium chloride

General Info

  • Alternative names

    • E. coli serine protease inhibitor
    • ECK2201
    • Ecotin
    • Ecotin, a serine protease inhibitor
    • eti
    • JW2197
    see all
  • Relevance

    E. coli serine protease inhibitor (Ecotin) inhibits pancreatic serine proteases: inhibits chymotrypsin, trypsin, elastases, factor X, kallikrein as well as a variety of other proteases. The strength of inhibition does not appear to be correlated with a particular protease specificity.
  • Cellular localization

    Periplasm.

Images

  • 15% SDS-PAGE analysis of 3µg ab103303.

References

ab103303 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab103303.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up