Recombinant E. coli fimH protein (Tagged) (ab236920)

Description

  • Product name

    Recombinant E. coli fimH protein (Tagged)
    See all fimH proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Escherichia coli
    • Sequence

      FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPE TITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTD KPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYA NNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGT TADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSL GLTANYARTGGQVTAGNVQSIIGVTFVYQ
    • Predicted molecular weight

      59 kDa including tags
    • Amino acids

      22 to 300
    • Tags

      His tag N-Terminus , GST tag N-Terminus
    • Additional sequence information

      Strain K12. This product is the mature full length protein from aa 22 to 300. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab236920 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Type 1 fimbrin D mannose specific adhesin
  • Cellular localization

    Fimbrium

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab236920.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab236920 could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) fimH.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab236920 could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) fimH.

References

ab236920 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236920.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up