Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Escherichia coli
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMTKYALVGDVGGTNARLALCDIASGEI SQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGCIAIACPITGDWVAMTNH TWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFGGAEPVEG KPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEIL RAEIGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSC TDCRRALSLFCVIMGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGF RAAFEDKGRFKEYVHDIPVYLIVHDNPGLLGSGAHLRQTLGHIL
    • Molecular weight

      37 kDa including tags
    • Amino acids

      1 to 321
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_416889

Specifications

Our Abpromise guarantee covers the use of ab183231 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 95 % SDS-PAGE.
    ab183231 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride, 10% Glycerol

General Info

  • Alternative names

    • ATP:D-hexose 6-phosphotransferase
    • FGQTL3
    • GCK
    • GK
    • GLK
    • Glucokinase
    • Hexokinase D pancreatic isozyme
    • Hexokinase type IV
    • Hexokinase-4
    • Hexokinase-D
    • HHF3
    • HK IV
    • HK4
    • HKIV
    • HXK4_HUMAN
    • HXKP
    • LGLK
    • MODY2
    see all
  • Function

    Catalyzes the initial step in utilization of glucose by the beta-cell and liver at physiological glucose concentration. Glucokinase has a high Km for glucose, and so it is effective only when glucose is abundant. The role of GCK is to provide G6P for the synthesis of glycogen. Pancreatic glucokinase plays an important role in modulating insulin secretion. Hepatic glucokinase helps to facilitate the uptake and conversion of glucose by acting as an insulin-sensitive determinant of hepatic glucose usage.
  • Tissue specificity

    Isoform 1 is expressed in pancreas. Isoform 2 and isoform 3 is expressed in liver.
  • Involvement in disease

    Defects in GCK are the cause of maturity-onset diabetes of the young type 2 (MODY2) [MIM:125851]; also shortened MODY-2. MODY is a form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease.
    Defects in GCK are the cause of familial hyperinsulinemic hypoglycemia type 3 (HHF3) [MIM:602485]; also known as persistent hyperinsulinemic hypoglycemia of infancy (PHHI) or congenital hyperinsulinism. HHF is the most common cause of persistent hypoglycemia in infancy. Unless early and aggressive intervention is undertaken, brain damage from recurrent episodes of hypoglycemia may occur.
  • Sequence similarities

    Belongs to the hexokinase family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab183231 (3µg).

References

ab183231 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab183231.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up