Recombinant E. coli Glycerol 3 Phosphate Dehydrogenase protein (His tag) (ab235854)

Description

  • Product name

    Recombinant E. coli Glycerol 3 Phosphate Dehydrogenase protein (His tag)
    See all Glycerol 3 Phosphate Dehydrogenase proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Escherichia coli
    • Sequence

      METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIH GGLRYLEHYEFRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWM IRIGLFMYDHLGKRTSLPGSTGLRFGANSVLKPEIKRGFEYSDCWVDDAR LVLANAQMVVRKGGEVLTRTRATSARRENGLWIVEAEDIDTGKKYSWQAR GLVNATGPWVKQFFDDGMHLPSPYGIRLIKGSHIVVPRVHTQKQAYILQN EDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLNVYNTHF KKQLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSV FGGKLTTYRKLAEHALEKLTPYYQGIGPAWTKESVLPGGAIEGDRDDYAA RLRRRYPFLTESLARHYARTYGSNSELLLGNAGTVSDLGEDFGHEFYEAE LKYLVDHEWVRRADDALWRRTKQGMWLNADQQSRVSQWLVEYTQQRLSLA S
    • Predicted molecular weight

      61 kDa including tags
    • Amino acids

      1 to 501
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab235854 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • AI747587
    • cytoplasmic
    • EC 1.1.1.8
    • FLJ26652
    • G3PD
    • Gdc-1
    • Gdc1
    • Gdp1
    • Glycerol 3 phosphate dehydrogenase 1
    • Glycerol 3 phosphate dehydrogenase cytosolic
    • Glycerol 3 phosphate dehydrogenase soluble
    • Glycerol-3-phosphate dehydrogenase
    • Glycerol-3-phosphate dehydrogenase [NAD+]
    • Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic
    • Glycerol-3-phosphate dehydrogenase 1 (soluble)
    • Glycerol-3-phosphate dehydrogenase, soluble
    • Glycerphosphate dehydrogenase
    • GPD-C
    • gpd1
    • Gpd1 protein
    • Gpd3
    • GPDA_HUMAN
    • Gpdc
    • GPDH
    • GPDH-C
    • Gpdhc
    • HTGTI
    • KIAA4010
    • MGC93453
    • MGPD
    • mKIAA4010
    see all
  • Sequence similarities

    Belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel using ab235854.

References

ab235854 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235854.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up