Description

  • Product name

    Recombinant E. coli Glycerol dehydrogenase protein
  • Biological activity

    Specific activity: > 14 Units/ml
    One unit will oxidize 1.0 µmole of glycerol to dihydroxyacetone per minute at pH 8.0 at 25°C.

  • Purity

    > 95 % SDS-PAGE.
    ab201880 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Escherichia coli
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMDRIIQSPGKYIQGADVINRLGEYLKP LAERWLVVGDKFVLGFAQSTVEKSFKDAGLVVEIAPFGGECSQNEIDRLR GIAETAQCGAILGIGGGKTLDTAKALAHFMGVPVAIAPTIASTDAPCSAL SVIYTDEGEFDRYLLLPNNPNMVIVDTKIVAGAPARLLAAGIGDALATWF EARACSRSGATTMAGGKCTQAALALAELCYNTLLEEGEKAMLAAEQHVVT PALERVIEANTYLSGVGFESGGLAAAHAVHNGLTAIPDAHHYYHGEKVAF GTLTQLVLENAPVEEIETVAALSHAVGLPITLAQLDIKEDVPAKMRIVAE AACAEGETIHNMPGGATPDQVYAALLVADQYGQRFLQEWE
    • Predicted molecular weight

      41 kDa including tags
    • Amino acids

      1 to 367
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_418380.

Specifications

Our Abpromise guarantee covers the use of ab201880 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • ECK3937
    • gldA
    • Glycerol dehydrogenase NAD
    • JW5556

Images

  • 15% SDS-PAGE analysis of ab201880 (3µg).

References

ab201880 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201880.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up