Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      AAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITK DGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIIT EGLKAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTIS ANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLS PYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIA EDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIATLTGGTVI SEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQ QIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALH ATRAAVEEGVVAGGGVALIRVASKLADLRGQNEDQNVGIKVALRAMEAPL RQIVLNCGEEPSVVANTVKGGDGNYGYNAATEEYGNMIDMGILDPTKVTR SALQYAASVAGLMITTECMVTDLPKNDAADLGAAGGMGGMGGMGGMM
    • Molecular weight
      57 kDa
    • Amino acids
      2 to 548

Specifications

Our Abpromise guarantee covers the use of ab157346 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Full activity after short incubation at room temperature.

  • Applications

    Functional Studies

  • Purity
    >= 99 % .

  • Form
    Liquid
  • Additional notes

    Full activity after short incubation at room temperature.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.075% Potassium chloride, 0.095% Magnesium chloride, 0.79% Tris HCl

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • 60 kDa chaperonin
    • groEL protein
    • groL
    • mopA
    • Protein Cpn60
    see all
  • Relevance
    The bacterial chaperonin groEL is a double toroidal assembly, which together with the action of the ring-shaped oligomeric cochaperonin, GroES, facilitates protein folding in an ATP dependent manner.
  • Cellular localization
    Cytoplasmic

References

ab157346 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157346.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up