Description

  • Product name

    Recombinant E. coli K99 pilus protein (His tag)
    See all E. coli K99 pilus proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Escherichia coli
    • Sequence

      NTGTINFNGKITSATCTIDPEVNGNRTSTIDLGQAAISGHGTVVDFKLKP APGSNDCLAKTNARIDWSGSMNSLGFNNTASGNTAAKGYHMTLRATNVGN GSGGANINTSFTTAEYTHTSAIQSFNYSAQLKKDDRAPSNGGYKAGVFTT SASFLVTYM
    • Predicted molecular weight

      33 kDa including tags
    • Amino acids

      23 to 181
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 23 to 181 with a 6x His-SUMO tag at the N-terminus. The signal peptide is not included.
  • Description

    Recombinant E. coli E. coli K99 pilus protein (His tag)

Specifications

Our Abpromise guarantee covers the use of ab224872 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • E.coli K99 protein
    • Escherichia coli K99 pilus
    • K99 pilus
  • Relevance

    K99 pilus antigen is frequently associated with enterotoxigenic strains of E. coli isolated from the intestine of calves, sheep and pigs. Pilus antigens have been shown to be the main attachment mechanism whereby EPEC attach to and colonize the small intestine of neonatal animals. Any mechanism which will interfere with this attachment and colonization process is capable of reducing the intestinal colonization, diarrhoea and mortality associated with K99 EPEC infections.
  • Cellular localization

    Cell Membrane

References

ab224872 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224872.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up