Recombinant E. coli Metalloprotease LoiP protein (His tag) (ab236176)

Description

  • Product name

    Recombinant E. coli Metalloprotease LoiP protein (His tag)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Escherichia coli
    • Sequence

      CQNMDSNGLLSSGAEAFQAYSLSDAQVKTLSDQACQEMDSKATIAPANSE YAKRLTTIANALGNNINGQPVNYKVYMAKDVNAFAMANGCIRVYSGLMDM MTDNEVEAVIGHEMGHVALGHVKKGMQVALGTNAVRVAAASAGGIVGSLS QSQLGNLGEKLVNSQFSQRQEAEADDYSYDLLRQRGISPAGLATSFEKLA KLEEGRQSSMFDDHPASAERAQHIRDRMSADGIK
    • Predicted molecular weight

      29 kDa including tags
    • Amino acids

      19 to 252
    • Tags

      His tag N-Terminus
    • Additional sequence information

      strain K12. This product is the mature full length protein from aa 19 to 252. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab236176 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab236176.

References

ab236176 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236176.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up