Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Escherichia coli
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMADKKLDTQLVNAGRSKKYTLGAVNSVIQR ASSLVFDSVEAKKHA TRNRANGELFYGRRGTLTHFSLQQAMCELEGGAGCVLFPCGAAAVANSIL AFIEQGDHVLMTNTA YEPSQDFCSKILSKLGVTTSWFDPLIGADIVKHLQPNTKIVFLESPGSIT MEVHDVPAIVAAVRS VVPDAIIMIDNTWAAGVLFKALDFGIDVSIQAATKYLVGHSDAMIGTAVC NARCWEQLRENAYLM GQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHPA LPGSKGHEFWKRDFT GSSGLFSFVLKKKLNNEELANYLDNFSLFSMAYSWGGYESLILANQPEHI AAIRPQGEIDFSGTL IRLHIGLEDVDDLIADLDAGFARIV
    • Molecular weight
      43 kDa
    • Amino acids
      1 to 395
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172819 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituent: 100% PBS

    Supplied as a 0.2 µM filtered solution.

General Info

  • Alternative names
    • Beta-cystathionase
    • CBL
    • Cystathionine beta lyase PLP dependent
    • Cystathionine beta-lyase metC
    • Cysteine lyase
    • metC
    • METC_ECOLI
    see all
  • Pathway
    Amino-acid biosynthesis; L-methionine biosynthesis via de novo pathway; L-homocysteine from L-cystathionine: step 1/1.
  • Sequence similarities
    Belongs to the trans-sulfuration enzymes family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab172819 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172819.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up