Recombinant E. coli Outer membrane protein C (His tag) (ab236921)

Description

  • Product name

    Recombinant E. coli Outer membrane protein C (His tag)
    See all Outer membrane protein C proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Escherichia coli
    • Sequence

      AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQL TGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDV TSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQ GKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSS KRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSL GWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDV GATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF
    • Predicted molecular weight

      42 kDa including tags
    • Amino acids

      22 to 367
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Strain K12. This product is the mature full length protein from aa 22 to 367. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab236921 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • ompC
    • OMPC_ECOLI
    • Outer membrane protein 1B
    • Outer membrane protein C
    • Porin ompC
    see all
  • Function

    Forms pores that allow passive diffusion of small molecules across the outer membrane.
  • Sequence similarities

    Belongs to the Gram-negative porin family.
  • Domain

    Loop L3 (residues 116-133) extends along the inner side of the beta barrel wall and may constrict the pore mid-length.
  • Cellular localization

    Cell outer membrane.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab236921.

References

ab236921 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236921.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up