Recombinant E. coli Outer membrane protein C (Tagged) (ab225590)

Description

  • Product name

    Recombinant E. coli Outer membrane protein C (Tagged)
    See all Outer membrane protein C proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Escherichia coli
    • Sequence

      AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQL TGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDV TSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQ GKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSS KRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSL GWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDV GATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF
    • Predicted molecular weight

      54 kDa including tags
    • Amino acids

      22 to 367
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the full-length mature protein with a 6xHis-SUMO tag at the N-terminus. The signal peptide is missing. Escherichia coli (strain K12)

Specifications

Our Abpromise guarantee covers the use of ab225590 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • ompC
    • OMPC_ECOLI
    • Outer membrane protein 1B
    • Outer membrane protein C
    • Porin ompC
    see all
  • Function

    Forms pores that allow passive diffusion of small molecules across the outer membrane.
  • Sequence similarities

    Belongs to the Gram-negative porin family.
  • Domain

    Loop L3 (residues 116-133) extends along the inner side of the beta barrel wall and may constrict the pore mid-length.
  • Cellular localization

    Cell outer membrane.
  • Information by UniProt

Images

  • Discontinuous SDS-PAGE (Tris-Glycine gel) (reduced) with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab225590 could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) ompC

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab225590 could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) ompC.

References

ab225590 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225590.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up