Description

  • Product name

    Recombinant EBNA2 protein (Tagged)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Epstein-Barr virus
    • Sequence

      MPTYYLALHGGQSYNLIVDTDMSGNPSLSVIPTNPYQEQLSNNPLIQLQI VVGENTGAPAPPQPPPPPPPPPPPERRDAWTQEPLPLDMNPLGSDASQGP LASSIRMLCMAQYLLRNARGQQGLLRPLGPQTRSQVTLERQPVHNPRQEA PIILLQSPAPPRFTPVPMVALGHTLQPTPPPRPTLPQPRIPLIIPPRHTN QPATTPPTAPQRLTLGHQLSLPPHPPPHQSTPHCSSDSTGLPPPPTSYSI PSMTLSPEPLPPPAAPAHPLPGVIYDQQALPPTPGPPWWPPVRDPTPTTQ TPPTNTKQGPDQGQGRGRWRGRGRSKGRGRMHKLPEPRRPGPDTSSPSMP QLSPVVSLHQGQGPENSPTPGPSTAGPVCRVTPSATPDISPIHEPESSDS EEPPFLFPSDWYPPTLEPAELDESWEGIFETTESHSSDEENVGGPSKRPR TSTQ
    • Amino acids

      247 to 454
    • Additional sequence information

      Epstein-Barr virus (strain AG876) (HHV-4) (Human herpesvirus 4). N-terminal 6xHis-tagged and C-terminal Myc-tagged

Specifications

Our Abpromise guarantee covers the use of ab241243 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • EBNA2
    • EBV
    • EBV nuclear antigen 2
    • Epstein Barr nuclear antigen 2
    • HHV4
    • Human Herpesvirus 4
    see all
  • Relevance

    The Epstein-Barr Virus (EBV), also called Human herpesvirus 4 (HHV-4), is a virus of the herpes family and is one of the most common viruses in humans. EBNA2 is one of the few genes of Epstein-Barr virus which are necessary for immortalization of human primary B lymphocytes. The EBNA2 protein acts as a transcriptional activator of several viral and cellular genes.
  • Cellular localization

    Nuclear matrix of host cells

Images

  • ab241243 analyzed by SDS-PAGE.

References

ab241243 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab241243.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up